Protein Info for Psest_2314 in Pseudomonas stutzeri RCH2

Annotation: Mg2+ and Co2+ transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 271 to 293 (23 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details PF01544: CorA" amino acids 42 to 327 (286 residues), 219 bits, see alignment E=4.5e-69

Best Hits

Swiss-Prot: 32% identical to ZNTB_CROS8: Zinc transport protein ZntB (zntB) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 88% identity to psa:PST_2041)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN83 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Psest_2314 Mg2+ and Co2+ transporters (Pseudomonas stutzeri RCH2)
MRETENDQCGLIHAFVLDGSGGARQVGYSDLAELQLAACESIWLHWDRGQPQAHEWLRRH
SGLSPFACDVLLEENTRPRMLTLPHEELLLFLRGVNLNPDAEPEDMVSVRVFADRQRVIS
LRLRPLRSTDVVIRLLTEGRGPKSASELLLYLAEAMTDRVDDLVMQLGERIDDEEEALES
NERYTPEHDSMLSLRRQAAGLRRFLLPQRELYGQLTRHRLSWFAEDDTEYWNELTNRLTR
YLEELDMVRERINLVLESEHRRLSERMNRTMYLLAIITGFFLPLSFLTGLLGINVGGIPG
ADFPYGFVVACVLIGGVALLQWWILRRLRWV