Protein Info for HP15_2209 in Marinobacter adhaerens HP15

Annotation: 4-amino-4-deoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03461: aminodeoxychorismate lyase
  • amino acids 12 to 258 (247 residues), 183.2 bits, E=2.6e-58
• PF01063: Aminotran_4
  • amino acids 24 to 249 (226 residues), 147.6 bits, E=2.7e-47

Best Hits

KEGG orthology group: K02619, 4-amino-4-deoxychorismate lyase [EC: 4.1.3.38] (inferred from 56% identity to maq:Maqu_1864)

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• 4-aminobenzoate biosynthesis II (1/2 steps found)
• superpathway of chorismate metabolism (41/59 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.38

Sequence Analysis Tools

See E4PFQ3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>HP15_2209 4-amino-4-deoxychorismate lyase (Marinobacter adhaerens HP15)
MFRLFWADDGGLPANDRGLAYGDGLFETIRMSGQKGVLLSRHLERMARDAGRLGIEVSRK
ELASVCVEAGQRFADRFKGDGWVLKLTLTRGSGGRGYRPDPGMEPNLLVSASALPPTPDS
DGVAVDFSKVTLAVNPLLAGVKSLNRMEQVLAAAELKPSLFEVIMADREGNLVEGTRTNI
LLRQADGWVTPPASSLAVAGVLRQWLLERLRQRGEPVTERPVTVPDVLGPDCQGMFLLNS
VLGIVPVLTIAGHHLPVDSGLATIFNPLETLE