Protein Info for Psest_2295 in Pseudomonas stutzeri RCH2

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 60 (26 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details PF01925: TauE" amino acids 11 to 248 (238 residues), 114.7 bits, see alignment E=2.8e-37

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 87% identity to psa:PST_2059)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNC0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Psest_2295 Predicted permeases (Pseudomonas stutzeri RCH2)
MDHSITTWAILLVAAFLGGGLNAIAGGGSFFTFPALVYAGVPAVAANASGTLALLPGYFA
STWGYREDLRPPATLSMGALVAISLGGGAAGAALLLTTPDDVFRAIVPWLLLVATLLFAF
GPWLLRRFKRDSTESEANAMVQGFTLAVVSVYGGYFNGGLGIVLLAAFSLLGHRDINSMQ
GLKNLVSSVLTAIAVSVYAFGGAILWREALVMMLAATVGGYVMARVGRRLPSSLVRAVVI
VTGSVMTVLFFRS