Protein Info for PGA1_c22820 in Phaeobacter inhibens DSM 17395

Annotation: lytic transglycosylase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01464: SLT
  • amino acids 82 to 176 (95 residues), 54.2 bits, E=5.3e-19

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See I7DSC3 at UniProt or InterPro

Protein Sequence (192 amino acids)

>PGA1_c22820 lytic transglycosylase-like protein (Phaeobacter inhibens DSM 17395)
MRADGQLETKAPQSGFAQSYVDGIGANPPELIVFAAPEPETQPPAPARAIPRPEILEALE
STAHRYGGHPALRRAGLSVSEWRALFQANIEIESAYRPNARSSAGAIGLGQLMPATAVQL
GVDPHNWQANLDGSARYLLMMLSRFGTPELALAAYNAGPDAVARYGGIPPYQETQNHVRR
VMAVRDRLTGAS