Protein Info for HP15_2200 in Marinobacter adhaerens HP15

Annotation: oxidoreductase FAD/NAD(P)-binding domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00970: FAD_binding_6" amino acids 15 to 97 (83 residues), 29.7 bits, see alignment E=6.6e-11 PF00175: NAD_binding_1" amino acids 112 to 228 (117 residues), 45.1 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 68% identical to FENR_AZOVI: Ferredoxin--NADP reductase (fpr) from Azotobacter vinelandii

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 92% identity to maq:Maqu_1856)

Predicted SEED Role

"Ferredoxin--NADP(+) reductase (EC 1.18.1.2)" in subsystem Biogenesis of cytochrome c oxidases (EC 1.18.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF84 at UniProt or InterPro

Protein Sequence (256 amino acids)

>HP15_2200 oxidoreductase FAD/NAD(P)-binding domain protein (Marinobacter adhaerens HP15)
MSNLIKEKVTSVHHWNDTLFSFTTSRDPGFRFKNGHFVMIGLETEGKPLMRAYSIASANY
EEELEFFSIKVQDGPLTSRLQKIQVGDEILVSRKPTGTLILDNLLPGKNLWLISTGTGLA
PFMSIIKDPEVYEAFDKVILTHGVRYVSELAYQKEIEELPENEYFGEMVQGKLVYYPTVT
REDFRNQGRLTDAMETGKITRDLDLPDFDPENDRFMICGSPSMLKDTCAILNNMGFKEAR
GGDMGHYVIERAFVEQ