Protein Info for HP15_2199 in Marinobacter adhaerens HP15

Annotation: glucose/sorbosone dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details PF07995: GSDH" amino acids 180 to 508 (329 residues), 439.3 bits, see alignment E=5.3e-136

Best Hits

Predicted SEED Role

"PQQ-dependent oxidoreductase, gdhB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF83 at UniProt or InterPro

Protein Sequence (511 amino acids)

>HP15_2199 glucose/sorbosone dehydrogenase (Marinobacter adhaerens HP15)
MALAVGVILGTVVQTQLNLWALQAMGVAVGLDARISATGHDLVSFAPLYLLLFGLSFLIS
QGAAAVVSRFVGRGLRVPLFGLAGASGLWVALVLVNALAPMPTLIAATRTGGGLLAMLLT
AAFAGALFARLTARPATGVSSHASGTLLAFCLAVGLGALPGPTQAQSLSDYTVETLTSGL
EHPWSLAFLPGGGALVTERAGRLRMISEEWELGQAPITGVPPVFNDAQAGLFDVLLSPDF
ENNQLVFLAYSCGTASANHLCVARGQLQAEALTEVVEIFRAKPAKEGSAHYGGRMAWLPD
GTLIVTLGDGFDYREQAQNLSSHLGKIVRLNPDGSVPADNPFVGREGALPEIYSYGHRNV
QGLVFDSVENVLIAHEHGPRGGDEINIIEPGHNYGWPVITHGIDYTGAMITPFVEREGME
QPLLHWTPSIAPSGMTRYRGELFPDWQGNLLVGALADKSVHRVTLEAGEASDVESLFEAM
GERIRDVATGPDGAVYLLTDSADGRILRILP