Protein Info for Psest_2292 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome c2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00034: Cytochrom_C" amino acids 47 to 125 (79 residues), 41.9 bits, see alignment E=2.1e-14 amino acids 175 to 280 (106 residues), 23.5 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: K02305, nitric oxide reductase, cytochrome c-containing subunit II (inferred from 66% identity to dia:Dtpsy_2768)

Predicted SEED Role

"Nitric-oxide reductase subunit C (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.7

Use Curated BLAST to search for 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLE2 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psest_2292 Cytochrome c2 (Pseudomonas stutzeri RCH2)
MNNRQARLFAIAATGVATLVFIGLTVDSHRQFPKLTNAENITAEVKHGMDVWHKYNCINC
HTLFGEGAYYAPDLTKITQHRGEPYLKAYMRDPSKFYDEKIHRRLMPQQNLAEDEISDLI
AFLDWASKVDNQGWPPRPILVTGSFVPGADTGGGQRDDTPPGARPVDADDDERALGEQVF
RSAVPACNACHSIAPGANMAGPTLAGLATRAAEVVASPDYQGQASDARGYIRESIVSPSA
HIIPGAMYSADGTSFMPTGYDKSLTDEKIDQLTAYLETLK