Protein Info for PGA1_c22790 in Phaeobacter inhibens DSM 17395

Annotation: glycine betaine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 99 to 121 (23 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 264 to 290 (27 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 166 to 331 (166 residues), 75.6 bits, see alignment E=2.1e-25

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 73% identity to rde:RD1_2931)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ENV4 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c22790 glycine betaine transport system permease protein (Phaeobacter inhibens DSM 17395)
MAFYDKLFSALGLSEWCGTSDDKAPLSLADLAAQAGGEEASGPLMPIPSFDNLHESCNRI
WQSRDVTNGIEEGFLAAKPVLKTVLDPITQPLSWMLDGALWLFEAMPWFIMVPLLVAISW
YASRSRPVTIFVAVSIMLLALVDHYDVAMQTLSIIFVCTTISVLFGVPIGIAMSKSDRLQ
KSVVPLLDLLQTLPTFVYLIPLIFLFSVTESKLYGIAIILYAIVPVIRLTDLGIRLVDQD
VIEAANAFGMNDRQKLMRVQLPLALPNIMAGINQTIMMSLAMVVIASLVSAPGLGVNVLR
GIRNLELGVGIVAGIGIVLLAVILDRVSKAALTRVDKTQVKH