Protein Info for Psest_2287 in Pseudomonas stutzeri RCH2

Annotation: ATP-dependent Clp protease, proteolytic subunit ClpP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR00493: ATP-dependent Clp endopeptidase, proteolytic subunit ClpP" amino acids 18 to 206 (189 residues), 350.3 bits, see alignment E=1.4e-109 PF00574: CLP_protease" amino acids 28 to 207 (180 residues), 294.9 bits, see alignment E=1.2e-92

Best Hits

Swiss-Prot: 88% identical to CLPP1_PSEAE: ATP-dependent Clp protease proteolytic subunit 1 (clpP1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 97% identity to psa:PST_2061)

MetaCyc: 76% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLD7 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Psest_2287 ATP-dependent Clp protease, proteolytic subunit ClpP (Pseudomonas stutzeri RCH2)
MSRNPFMQVPDIQAAGGLVPMVIEQSARGERAYDIYSRLLKERVIFMVGQVEDYMANLIV
AQMLFLEAENPEKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGALLLT
GGTAGKRYCLPHSRMMIHQPLGGFQGQASDIEIHAREILTIRERLNKVLAHHTGQPMDVI
ARDTDRDNFMSGEDAVKYGLIDQVLTQRQLAV