Protein Info for HP15_2192 in Marinobacter adhaerens HP15

Annotation: UDP-2,3-diacylglucosamine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00149: Metallophos" amino acids 1 to 199 (199 residues), 40.9 bits, see alignment E=3.1e-14 TIGR01854: UDP-2,3-diacylglucosamine diphosphatase" amino acids 3 to 228 (226 residues), 325.1 bits, see alignment E=1e-101

Best Hits

Swiss-Prot: 81% identical to LPXH_MARHV: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 81% identity to maq:Maqu_1847)

MetaCyc: 52% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF76 at UniProt or InterPro

Protein Sequence (241 amino acids)

>HP15_2192 UDP-2,3-diacylglucosamine hydrolase (Marinobacter adhaerens HP15)
MTTLFISDLHLEESRPDITEAFLGFLDGKASGVDQLYILGDFFEAWIGDDERTPLQEQIA
TALRKLRDSGTRIFLMHGNRDFLIGQDFCDRAGATLLDDPTVIDLYGTPTLLMHGDSLCT
ADVEYQKFRANMRNPQWQQMILQRPLKDRQQMARQLREISMAKNQGKEEFIMDVTPEEVV
KDLETHGVQRMIHGHTHRPAVHELTANGSPAKRIVLGDWDKNVWWLEAEPGKEPELFKEP
L