Protein Info for PGA1_c22720 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF12625: Arabinose_bd" amino acids 33 to 206 (174 residues), 103 bits, see alignment E=3.3e-33 PF12833: HTH_18" amino acids 260 to 336 (77 residues), 69.4 bits, see alignment E=4.1e-23 PF00165: HTH_AraC" amino acids 298 to 336 (39 residues), 39.9 bits, see alignment 5.3e-14

Best Hits

KEGG orthology group: None (inferred from 74% identity to dsh:Dshi_2601)

Predicted SEED Role

"AraC-type DNA-binding domain-containing proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DSB3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PGA1_c22720 putative transcriptional regulator, AraC family (Phaeobacter inhibens DSM 17395)
MTNVAPTILSTVSSQFVDDWLAALRALCPEAQMASLLSRSGLNADTRSPNGRVTLDQIVC
LYQLAAVETGDEMMGLWSRPVRPRALQHLLTTVREATSLPSALYRFSTFWNLLLDDYQFD
LDDTDSALTLSLNPQTDAPVQRFGHMLILKLAHGLMSWLAGHEVPVKAVDFAFHRPDFNQ
DYAIIFPAPFQFGQPATAISFSPNALGPVQARSTSDLDRFLQNAPRDWIFTSSREHTQSL
RVRTYLGQTGWDAATLTQTASAMHMTPRTLIRRLQADGTSFQAIKDALRRDIAIRDLQAG
RKSVEAIAHDVGFSSAANFHRAFQRWTGSTPSSYRRTNI