Protein Info for Psest_0225 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details PF00892: EamA" amino acids 12 to 137 (126 residues), 57.3 bits, see alignment E=1.1e-19 amino acids 146 to 283 (138 residues), 62.2 bits, see alignment E=3.3e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_4021)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFN8 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psest_0225 Predicted permease, DMT superfamily (Pseudomonas stutzeri RCH2)
MKGTWRQGLWLADGMLLMVALIWGSSYAVAKQALLFYPVLGFLAIRFGLTFVLLLPQLRG
AGRRALRPGLPLGLVMLAIFLCETWGVMLTSASNAAFLISLCVVITPFMEWLLLRQRPHN
TLFLACGLSLAGVWLLTGGPQLSLNLGDALMLAAALLRAVLVCLTRRMTAGREIPALALT
AVQSGVVAAGCILLAMLLPGGLPALPVEPGFWFGTLYLVLFATLFAMFAQNRALGRSSAT
RVSLLMGSEPLFGAIIAGVWLGERLGPMGWAGGLLIMLATLCTLGIGRQPAPSMAGDGAP
ARA