Protein Info for HP15_2189 in Marinobacter adhaerens HP15

Annotation: cysteinyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00435: cysteine--tRNA ligase" amino acids 3 to 461 (459 residues), 596.3 bits, see alignment E=2.6e-183 PF01406: tRNA-synt_1e" amino acids 15 to 312 (298 residues), 457.8 bits, see alignment E=4.8e-141 PF09334: tRNA-synt_1g" amino acids 35 to 105 (71 residues), 26.6 bits, see alignment E=6.3e-10 amino acids 243 to 311 (69 residues), 27.6 bits, see alignment E=3.3e-10 PF09190: DALR_2" amino acids 342 to 404 (63 residues), 76.5 bits, see alignment E=4.6e-25

Best Hits

Swiss-Prot: 89% identical to SYC_MARHV: Cysteine--tRNA ligase (cysS) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 89% identity to maq:Maqu_1844)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF73 at UniProt or InterPro

Protein Sequence (462 amino acids)

>HP15_2189 cysteinyl-tRNA synthetase (Marinobacter adhaerens HP15)
MIRIYNTLTQQKEEFRPIEPGKVRMYVCGMTVYDYCHLGHARVLVAFDVITRYLRHRGYD
VNYVRNITDIDDKILRRADENGEPYDELTDRMIKAMHEDEARLGVLSPDEEPRATAYIDE
IIAMIHKLIAGGHAYAADNGDVYFAVDSFDDYGKLSKKKLEDLLAGARVDVQEAKRSPAD
FALWKAAKAGEVSWPSPWGDGRPGWHIECSAMSTCCLGETFDIHGGGPDLLFPHHENEIA
QSECATGHTFVNTWMHAGAIRVNKEKMSKSLGNFFTIREIMEKYPAEVVRYFLVSSHYRS
QVDYSEENLAEAGRTLTRLYHALRGIVPAKAADVPESEHDERFAEAMDDDFNTAGAIAVL
HAVANEINQHRRDGREDDAKQSAAILVRLGGVLGLLQQDPEAFFQADTGGELSAEDIEAM
IQARADARKAKNFAEADRIRDELLEKGIILDDSREGTTWRKA