Protein Info for Psest_2281 in Pseudomonas stutzeri RCH2

Annotation: Phosphoserine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00266: Aminotran_5" amino acids 12 to 354 (343 residues), 139.4 bits, see alignment E=7.7e-45

Best Hits

Swiss-Prot: 48% identical to SERC_NITEU: Phosphoserine aminotransferase (serC) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 49% identity to nit:NAL212_1124)

MetaCyc: 40% identical to phosphoserine aminotransferase (Arabidopsis thaliana col)
Phosphoserine transaminase. [EC: 2.6.1.52]

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.52

Use Curated BLAST to search for 2.6.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN52 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Psest_2281 Phosphoserine aminotransferase (Pseudomonas stutzeri RCH2)
MACTSSERAERYNFASGPAMLPAEVLEQIRDELPNWRNTGSSVLEQPFTSTDFKQLMAET
EADLRALLTIPDNYRVLFMQGGASAQFGLLPLNLLQPGQSADYLESGHWARKAITEARRH
SPVNVVASGADQAFTALPPLDHWQLDPAAGYCHVTSNETGNGLQLQKFPELVVPLVADMT
SDFLTRQLPLERFGLIYASAQKNLGIAGLCIVIIRNDLLRAPPPGLPTAFSYATQAEQQS
RFNTPPTFAVYVTGLMLRWMGRNGGVPAMAAAAQQKSCLLYRCVDNSDLYLCPQRPADRS
PINVCFQLTKPGLTETFLTEAERNGLTNLRGHAAIGGIRASLYNPMPLSGVARLVEFMTD
FERKHG