Protein Info for Psest_2278 in Pseudomonas stutzeri RCH2

Annotation: coenzyme PQQ biosynthesis protein PqqD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 TIGR03859: coenzyme PQQ biosynthesis protein PqqD" amino acids 16 to 94 (79 residues), 83.1 bits, see alignment E=5.1e-28 PF05402: PqqD" amino acids 30 to 94 (65 residues), 62.5 bits, see alignment E=2e-21

Best Hits

Swiss-Prot: 44% identical to PQQD_AZOVD: PqqA binding protein (pqqD) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: None (inferred from 81% identity to psa:PST_2069)

Predicted SEED Role

"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLY9 at UniProt or InterPro

Protein Sequence (98 amino acids)

>Psest_2278 coenzyme PQQ biosynthesis protein PqqD (Pseudomonas stutzeri RCH2)
MTTTTMISPACRYEIRPPFLFRWEDSQQAHVLLYPEGIVKLNVTGGEILRRCDGKTSVAE
LIDQLALSYNASDVDAIRNGVLNFLEVSHGKGWIRAKA