Protein Info for Psest_2272 in Pseudomonas stutzeri RCH2

Annotation: coenzyme PQQ biosynthesis protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR02111: coenzyme PQQ biosynthesis protein C" amino acids 6 to 241 (236 residues), 409.7 bits, see alignment E=1.7e-127 PF03070: TENA_THI-4" amino acids 15 to 222 (208 residues), 203.9 bits, see alignment E=1.3e-64

Best Hits

Swiss-Prot: 89% identical to PQQC_PSEMY: Pyrroloquinoline-quinone synthase (pqqC) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K06137, pyrroloquinoline-quinone synthase [EC: 1.3.3.11] (inferred from 89% identity to pmy:Pmen_1967)

MetaCyc: 73% identical to pyrroloquinoline-quinone synthase monomer (Klebsiella pneumoniae)
Pyrroloquinoline-quinone synthase. [EC: 1.3.3.11]

Predicted SEED Role

"Pyrroloquinoline-quinone synthase (EC 1.3.3.11)" (EC 1.3.3.11)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLB9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Psest_2272 coenzyme PQQ biosynthesis protein C (Pseudomonas stutzeri RCH2)
MNLPAMSPAEFEQALRAKGEYYHIHHPFHRAMYAGQATREQIQGWVANRFYYQVCIPVKD
AAIMANCPDRDTRREWIQRIIDHDGAPGEEGGIEAWLRLAEAVGLDREQVLSQELVLPGV
RFAVDAYVNFARRASWQEAASSSLTELFAPTIHQSRLDSWPQHYPWIDASGYDYFRKRLK
EARRDVEHGLRITLDHYRTRDAQERMLEILQFKLDVLWSMLDAMSMAYELDRPPYHTVTR
ERIWHKGISV