Protein Info for Psest_2267 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 TIGR00229: PAS domain S-box protein" amino acids 40 to 164 (125 residues), 42.7 bits, see alignment E=2.8e-15 PF13188: PAS_8" amino acids 43 to 101 (59 residues), 28 bits, see alignment 3.8e-10 PF00989: PAS" amino acids 45 to 151 (107 residues), 26.7 bits, see alignment E=1.2e-09 PF00512: HisKA" amino acids 196 to 259 (64 residues), 35.7 bits, see alignment E=1.8e-12 PF02518: HATPase_c" amino acids 306 to 414 (109 residues), 81.5 bits, see alignment E=1.5e-26 PF00072: Response_reg" amino acids 441 to 549 (109 residues), 45.9 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 85% identity to psa:PST_2079)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLB4 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Psest_2267 PAS domain S-box (Pseudomonas stutzeri RCH2)
MPKPSDDQHQALTQLLGFGSHSARKSHYPELVARLEELEAERNRYKWLFEHAVHGIFQAS
LQEGIRAANPALARMLGYETAEDALWTLTDLSHHLFIGGEEELRQIRHTLSQQNGLFGYE
TRLRRKDGSAIYVIMNLLLKPDEDGLVEGFVADVTERKLAQLRLLQLNEELEQRVAERTC
ELREARDAAEAANLSKDKYLAAASHDLLQPLNAARLLISTLRERQLPQSELHLVERAHLA
LEGAEDLLTDLLDISKLDQAAIKPDIDAYSLDDILLPLISEFQPVAAAKGLQLSHYLPRC
AISCDFRLLTRILRNLLSNACRYTDAGGVLLGARKRGDMLRIEVWDTGRGIPEEDLHSIF
LEFNQLGVSRAAERSGVGLGLAIVDRIANMLDYRVLVRSRPGRGSVFSIDVPMAATVPPR
SAVTPVIAPQLGDPLPGRRLLVIDNETSILHSMAALLEQWGCTVVTATDEQTAIAALGGV
APDAILADYHLDHGSTGWDVVLALRARFSTRLPVVMITADRSDQCRRQLQGVGVPVLNKP
VKPGKMRSVLSHLLSGDGTDGSNEV