Protein Info for HP15_2176 in Marinobacter adhaerens HP15
Annotation: pyruvate kinase II
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to KPYK2_SALTY: Pyruvate kinase II (pykA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 90% identity to maq:Maqu_1831)MetaCyc: 64% identical to pyruvate kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyruvate kinase. [EC: 2.7.1.40]
Predicted SEED Role
"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)
MetaCyc Pathways
- Bifidobacterium shunt (15/15 steps found)
- homolactic fermentation (11/12 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- glycolysis III (from glucose) (10/11 steps found)
- Rubisco shunt (9/10 steps found)
- glycolysis IV (9/10 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- heterolactic fermentation (14/18 steps found)
- superpathway of glucose and xylose degradation (13/17 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- mixed acid fermentation (11/16 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- superpathway of hexitol degradation (bacteria) (12/18 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
- glycerol degradation to butanol (10/16 steps found)
- superpathway of N-acetylneuraminate degradation (13/22 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Glycolysis / Gluconeogenesis
- Purine metabolism
- Pyruvate metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.40
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PF60 at UniProt or InterPro
Protein Sequence (482 amino acids)
>HP15_2176 pyruvate kinase II (Marinobacter adhaerens HP15) MLRRTKIVATLGPATDSPESLAAIIAAGVDVTRLNFSHGSAEEHIGRARRVREAAAAQGR FVALLADLQGPKLRIARFSENKVTLKAGQTFILDAAMDKEAGTEEKVGIDYEQLIEDVEP GDILVLDDGRIEMEVQSVSDHSITSTVLIGGPLSNNKGLNKRGGGLSADALTEKDKQDIV TAAKLGADYVAVSFVRTAEDMHIARRLLKEAGSDAGLVAKIERAELADDVEALDAVIEAS DAVMVARGDLAVEIGDAQLVGVQKHIISRARVLNRAVITATQMMESMITSPMPTRAEVSD VANAVMDYTDAVMLSAETAVGDYPKEAVEAMVRICLGAEKHPSMHQSKHRIHESMEEVDE AIALSAMYAANHLEGVSAIICMTETGATPRLMSRIKSSLPIFAFSRHHSTQHRVVMFRGV QTVPFDSAKIPNERTNALAVSELVNRGAVKDGDLVVITKGDYVNAQGGTNTMKIVRVGSD IR