Protein Info for Psest_2264 in Pseudomonas stutzeri RCH2

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF19335: HMBD" amino acids 49 to 75 (27 residues), 37.3 bits, see alignment (E = 6.5e-13) PF16576: HlyD_D23" amino acids 109 to 317 (209 residues), 232.1 bits, see alignment E=1.4e-72 PF16572: HlyD_D4" amino acids 155 to 207 (53 residues), 91.6 bits, see alignment 6.9e-30 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 198 to 392 (195 residues), 125.9 bits, see alignment E=8.4e-41 PF13437: HlyD_3" amino acids 213 to 314 (102 residues), 71.2 bits, see alignment E=3.3e-23 PF11604: CusF_Ec" amino acids 433 to 489 (57 residues), 61.7 bits, see alignment 1.6e-20

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 79% identity to psa:PST_2082)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ64 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Psest_2264 RND family efflux transporter, MFP subunit (Pseudomonas stutzeri RCH2)
MSRNTFANLSLAALTALLGGAAGYWLASQNEHGAEHLEPAVASQAQVLYWYDPMVPQHRF
DKPGKSPFMDMDLVPRYAGEDGDAAAINIDAGITQNLGVRLASVTRGQLASQIEAVGVLE
YNARDVAVVQVRAGGFVERVYHHAPGDLLDKGTPLADLLIPEWSAAQEEYLALRRIGEPA
LLEAARQRLRLAGMPAATISQLERTGKVSASITISTPIAGVLQELDVREGMSLAAGAPLA
RINGLDSVWLEVAVPEAQSTGIRVGQRATARLPAMPGERIEGTITAVLPEANAASRTLRV
RVQLPNPQGLLRPGLTAQATLKGADDTSVLLIPSEAVIRTGRRSLVMLAEAGGRYRPVEV
ETGRDSGNQTAIVAGLEEGQQVVASGQFLLDSEASLRGIVASPATGDTGHAHDHAQIAPA
LHESEGRVLALSENRLKIAHGPFHTLGMPGMTMSFAVADSELLRGVQAQDRIRFAVRETD
QGLLIERVQLMEKQP