Protein Info for Psest_2258 in Pseudomonas stutzeri RCH2
Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to PGSA_SHIBS: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) from Shigella boydii serotype 4 (strain Sb227)
KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 97% identity to psa:PST_2087)MetaCyc: 63% identical to CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. [EC: 2.7.8.5]
Predicted SEED Role
"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)
MetaCyc Pathways
- phosphatidylglycerol biosynthesis I (6/6 steps found)
- phosphatidylglycerol biosynthesis II (6/6 steps found)
- superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
- cardiolipin biosynthesis II (3/3 steps found)
- cardiolipin biosynthesis I (2/3 steps found)
- cardiolipin biosynthesis III (2/3 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
- type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
- superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.8.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GLX0 at UniProt or InterPro
Protein Sequence (204 amino acids)
>Psest_2258 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Pseudomonas stutzeri RCH2) MQLCTVSKLFPEFRRSVVPMNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFTVAA LTDWLDGYLARRLEQSTPFGAFLDPVADKLMVAVALVLLVEEHANLWLTLPAAIIIGREI VVSALREWMAELGARAQVAVSNLGKWKTAAQMAALVILLANPPQPTIWVGLGYALLIVAA GLTLWSMINYLMAAWPHLSTTEKK