Protein Info for Psest_2258 in Pseudomonas stutzeri RCH2

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 146 to 161 (16 residues), see Phobius details amino acids 167 to 194 (28 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 20 to 185 (166 residues), 133.4 bits, see alignment E=4.6e-43 TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 20 to 198 (179 residues), 188.7 bits, see alignment E=6.9e-60

Best Hits

Swiss-Prot: 63% identical to PGSA_SHIBS: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 97% identity to psa:PST_2087)

MetaCyc: 63% identical to CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. [EC: 2.7.8.5]

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLX0 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Psest_2258 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Pseudomonas stutzeri RCH2)
MQLCTVSKLFPEFRRSVVPMNIPNLLTVLRVLLIPIFILLFYLPFYWSYLAASAVFTVAA
LTDWLDGYLARRLEQSTPFGAFLDPVADKLMVAVALVLLVEEHANLWLTLPAAIIIGREI
VVSALREWMAELGARAQVAVSNLGKWKTAAQMAALVILLANPPQPTIWVGLGYALLIVAA
GLTLWSMINYLMAAWPHLSTTEKK