Protein Info for Psest_2250 in Pseudomonas stutzeri RCH2

Annotation: Predicted flavoprotein involved in K+ transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 8 to 189 (182 residues), 37.9 bits, see alignment E=4.3e-13 PF13738: Pyr_redox_3" amino acids 10 to 192 (183 residues), 81.6 bits, see alignment E=2e-26 PF13450: NAD_binding_8" amino acids 11 to 45 (35 residues), 27.9 bits, see alignment 7.2e-10 PF13434: Lys_Orn_oxgnase" amino acids 118 to 196 (79 residues), 26.1 bits, see alignment E=1.4e-09 PF00743: FMO-like" amino acids 123 to 191 (69 residues), 42.9 bits, see alignment E=7.5e-15

Best Hits

KEGG orthology group: None (inferred from 81% identity to psa:PST_2095)

MetaCyc: 58% identical to [arsenate oxidoreductase]-[AioE protein] oxidoreductase (Agrobacterium tumefaciens GW4)
1.20.98.-

Predicted SEED Role

"monooxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL96 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Psest_2250 Predicted flavoprotein involved in K+ transport (Pseudomonas stutzeri RCH2)
MTAPNVLDVIIIGAGQSALTTAYFLRRTSLSYLLLDEQPSPGGAWLHAWESLRLFSPAAW
SSIAGWPMPAPVEPGNPTRSDVIDYLRRYEDRYRFPIQRSVRVDTISRLDDLWLVQAGDQ
HWLARAVISATGTWSKPFIPPYEGRELFQGAQIHSAHYRDPGPFAGKRVMVVGGGNSGAQ
VLAELSRVSETRWVTQEPPAFLPDDVDGRVLFERATARWKAQQEGRSIDEPAGGFGDIVM
VPPVRKARERGVLGAERPFARFTETGVEWADGRREDLDAVIWCTGFRPALDHLRELGIIE
ADGKVQVEGTRVVKQPNLWLVGYGDWTGMASATLIGVTRTARSTVDELVQALAATSLQRP