Protein Info for HP15_2158 in Marinobacter adhaerens HP15

Annotation: ABC-type sugar transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF01547: SBP_bac_1" amino acids 91 to 413 (323 residues), 36.6 bits, see alignment E=5.6e-13 PF13416: SBP_bac_8" amino acids 91 to 452 (362 residues), 32.3 bits, see alignment E=9.1e-12

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 79% identity to pmk:MDS_2147)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF42 at UniProt or InterPro

Protein Sequence (580 amino acids)

>HP15_2158 ABC-type sugar transport system, periplasmic component (Marinobacter adhaerens HP15)
MFNNNKYPRTLLLSAAVGVASLGLSLHVSADQYSEAAEKWVNEAFKNSTLSKEEQLKEME
WFTKAAEQFRGMDINVVSETIATHEYESNVLAKAFSEITGINLTHTLIQEGDVIEKLQTQ
MQSGRNIYDGYVNDSDLIGTHFRYGKVVAVEDIMNGAGKDLTLPTLDLDDFIGLDFTTGP
DGKLYQLPSQQFANLYWFRADWFEREDLQKQFKDIYGYDLGVPVNWSAYEDIAEFFSVHV
KEIDGERVYGHMDYGKKDPSLGWRFTDAWFSMAGAGDKGLPNGLPVDEWGIRVEECHPVG
SSVSRGGATNGPAAVYATEKYVDWLREYAPPEAQGMTFSEAGPVPAQGNVAQQIFWYTAF
TASMIKDGLPVVNEDGTPKWRMAPSPRGPYWEEGMKLGYQDVGSWTFLDSTPEKRRLAAW
LYAQFTVSKTVSLEKTIAGLTPIRESDIESEAMTEMAPKLGGLVEFYRSPARVQWSPTGT
NVPDYPKLAQLWWQYIAQAASGEATPQEALDGLAQAQDRVMERLERANVQPTCGPKLNEP
RDPQYWLDQPGAPKPKLANEKPQGKTVAYDELLKTWEEAR