Protein Info for Psest_2248 in Pseudomonas stutzeri RCH2

Annotation: Predicted transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF01022: HTH_5" amino acids 16 to 62 (47 residues), 51.8 bits, see alignment E=2.9e-18

Best Hits

Swiss-Prot: 64% identical to ARSR1_PSEPK: Arsenic resistance transcriptional regulator ArsR1 (arsR1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 92% identity to psa:PST_2096)

Predicted SEED Role

"Arsenical resistance operon repressor" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN80 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Psest_2248 Predicted transcriptional regulators (Pseudomonas stutzeri RCH2)
MVEHLTPTTVFKCLADETRVRIALLVAREGELCVCELTCALDESQPKISRHLALLRGCGI
LEDRRQGQWVYYRLHPHLPDWVTDMLQPILAANKNWLGDNVQRLESMRNRPERASSCA