Protein Info for Psest_2246 in Pseudomonas stutzeri RCH2

Annotation: arsenical resistance protein ArsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR02690: arsenical resistance protein ArsH" amino acids 5 to 223 (219 residues), 417.2 bits, see alignment E=5.1e-130 PF03358: FMN_red" amino acids 31 to 174 (144 residues), 119.7 bits, see alignment E=4.3e-39

Best Hits

Swiss-Prot: 75% identical to ARREH_ACIF2: NADPH-dependent FMN reductase ArsH (arsH) from Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)

KEGG orthology group: K11811, arsenical resistance protein ArsH (inferred from 94% identity to psa:PST_2097)

MetaCyc: 82% identical to ArsH (Pseudomonas putida KT2440)

Predicted SEED Role

"Arsenic resistance protein ArsH" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLW1 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Psest_2246 arsenical resistance protein ArsH (Pseudomonas stutzeri RCH2)
MNDDLPNIDPGLLDMPDLDKLALPAGPEHRPRILLLYGSNRERSYSRLLVQEAARLLERF
GAETRIFNPSGLPLPDDAPDSHPKVQELRELMQWSEGQVWCSPERHGSMSAVFKAQIDWV
PLAMGAVRPTQGKTLAIMQVSGGSQSFNALNQMRVLGRWMRMITIPNQSSVAKAFLEFDD
AGRMKPSAYYDRVVDVMEELIKFTLLVRCRADYLVDRYSERKESAEALSRRVNQRSI