Protein Info for PGA1_c00220 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF00892: EamA" amino acids 8 to 137 (130 residues), 50.6 bits, see alignment E=1.2e-17 amino acids 151 to 287 (137 residues), 50.5 bits, see alignment E=1.4e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVG4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>PGA1_c00220 Predicted permeases (Phaeobacter inhibens DSM 17395)
MRRFLPYLAASFTGIQVGAALVASEAVVEKTGAAGLGFWRYLIASIVLVPFWIASRKPRI
GRGDLLPISIIGIGQFGLLIAMLNVAVLLASSARVSLVFAALPLATLAFERMIFHMRISK
AEMLAILLSLLGIAVLLGTDLYASATGPFELLGLLAALVATLTGAVCSGYLRPYVRRYGG
VQVSLLAMLASLVPLSAFAALEPQGLSTGGSTYATVLLVVGIGLSSGAGFWCWLYALSHI
PAGHVTAFLGLSPVTATLLSVAFKDESPKASVIAALGLVVAALLVLVFAKGTKSTR