Protein Info for HP15_22 in Marinobacter adhaerens HP15

Annotation: aromatic-ring-hydroxylating dioxygenase beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF00866: Ring_hydroxyl_B" amino acids 39 to 182 (144 residues), 96.9 bits, see alignment E=5.7e-32

Best Hits

Swiss-Prot: 38% identical to BPHA2_RHOJR: Biphenyl 2,3-dioxygenase subunit beta (bphA2) from Rhodococcus jostii (strain RHA1)

KEGG orthology group: None (inferred from 69% identity to cak:Caul_1975)

Predicted SEED Role

"Biphenyl dioxygenase beta subunit (EC 1.14.12.18)" in subsystem Biphenyl Degradation (EC 1.14.12.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI81 at UniProt or InterPro

Protein Sequence (191 amino acids)

>HP15_22 aromatic-ring-hydroxylating dioxygenase beta subunit (Marinobacter adhaerens HP15)
MNELQRLLEPSPLPPTDRAKRISSGDPLYHEIVDFFHDEAELLDNLQLKQWGESLTRDLE
YNLPIRQTHPVRHQDKTVVRTVQHMHDTYESMMVRIMRITDTKSAWGEDPPSRTKRLIGN
VRVFRTSKPDEYKVLSYLLVTRSRFDFDDFDLIPCERHDILRRESGRLKLARREVIVDQA
VIGTPNLGIFF