Protein Info for Psest_2243 in Pseudomonas stutzeri RCH2

Annotation: glyceraldehyde-3-phosphate dehydrogenase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00044: Gp_dh_N" amino acids 3 to 101 (99 residues), 102.7 bits, see alignment E=1.2e-33 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 4 to 324 (321 residues), 390.8 bits, see alignment E=2.7e-121 PF02800: Gp_dh_C" amino acids 157 to 313 (157 residues), 205 bits, see alignment E=5e-65

Best Hits

Swiss-Prot: 69% identical to G3P3_NOSS1: Glyceraldehyde-3-phosphate dehydrogenase 3 (gap3) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 95% identity to psa:PST_2100)

MetaCyc: 90% identical to glyceraldehyde-3-phosphate dehydrogenase (arsenate-transferring) (Pseudomonas aeruginosa)
RXN1YI0-11 [EC: 1.2.1.107]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.107 or 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN75 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Psest_2243 glyceraldehyde-3-phosphate dehydrogenase, type I (Pseudomonas stutzeri RCH2)
MSIKVGINGFGRIGRLALRAAWDWPELDFVQINDPAGDAATHAHLLNFDSIHGRWKHEAG
SDGDCLVIDGQRVKVSANKAISDTDWSGCDLVIEASGKMKTVAVLQQYLEQGVKRVVVSA
PVKESGALNIVMGVNDSLFDPAQHRIVTAASCTTNCLAPVVKVIHEQLGIRHGSITTIHD
LTNTQSILDQPHKDLRRARASGMSLIPTTTGSATAIAEIFPELRGKLNGHAVRVPLANAS
LTDCVFEVERATDAAEVNRLLKAAAEGELKGILGYEERPLVSIDYRTDPRSSIIDALSTM
VVNGTQVKIYAWYDNEWGYANRTVELARNVGLAG