Protein Info for PGA1_c02300 in Phaeobacter inhibens DSM 17395

Annotation: putative glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF13641: Glyco_tranf_2_3" amino acids 5 to 117 (113 residues), 38 bits, see alignment E=1.6e-13 PF00535: Glycos_transf_2" amino acids 6 to 167 (162 residues), 94.7 bits, see alignment E=6.4e-31

Best Hits

KEGG orthology group: None (inferred from 81% identity to sit:TM1040_1484)

Predicted SEED Role

"FIG00919120: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVY5 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_c02300 putative glycosyl transferase (Phaeobacter inhibens DSM 17395)
MTKTISIVIPTFNRADMLPKAVDCALNQTVPCEVIVSDHGSTDHTAQVAEKYGDKITYIR
REKDFGPHFCWLEGVLHATGEFVHLQYDDDWIAPTFIEKCASVLKEDVGFAFTGAEVIDD
KTGKQMMVQFLEWLPETGIFDNRLAEENIVGSLISPGAALFRRQVLIDALYQGRLPLQSS
EYHGVGPDIFASLLSMLRYPKVGFVKEPLASFRAHDGSITINALKDKEKAANIAAAYNEV
RHYYVELKAMQAVRGAQT