Protein Info for Psest_2232 in Pseudomonas stutzeri RCH2
Annotation: UTP-glucose-1-phosphate uridylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to GALU_PSEAE: UTP--glucose-1-phosphate uridylyltransferase (galU) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 97% identity to psa:PST_2111)Predicted SEED Role
"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)
MetaCyc Pathways
- colanic acid building blocks biosynthesis (10/11 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- UDP-α-D-glucose biosynthesis (2/2 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- sucrose biosynthesis II (6/8 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- sucrose degradation II (sucrose synthase) (3/5 steps found)
- stachyose degradation (2/7 steps found)
- type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
KEGG Metabolic Maps
- Galactose metabolism
- Nucleotide sugars metabolism
- Pentose and glucuronate interconversions
- Starch and sucrose metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GN66 at UniProt or InterPro
Protein Sequence (279 amino acids)
>Psest_2232 UTP-glucose-1-phosphate uridylyltransferase (Pseudomonas stutzeri RCH2) MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLNQIAIVTGRGKR SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIG DEPFAVVLADDLCINLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD DIYRVSHMVEKPKPEDAPSNMAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMRQAQD GCVLAYKFKGQRFDCGSAEGYIAATNFCYEHFYLTGKAF