Protein Info for Psest_2228 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details PF13088: BNR_2" amino acids 78 to 408 (331 residues), 255.2 bits, see alignment E=3.8e-80

Best Hits

KEGG orthology group: None (inferred from 68% identity to pfl:PFL_3849)

Predicted SEED Role

"BNR/Asp-box repeat protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMZ8 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Psest_2228 hypothetical protein (Pseudomonas stutzeri RCH2)
MGSEKSRLFVFGLCAAVLASIFTISWWLHPDRAVAGFAVAAGSVELAGATTPFYSTRFAS
SDLDEFVHASSVTSLPGGKLMAVWFAGSREGAADVQIRGARYDALTAEWGEELVLATRES
TQQATRKYIRKLGNSVIALAPDNRLWLFYVSVSIGGWAGSAINTMYSDDFGQSWSTPKQL
ITTPFLNISTLVRNAPVFHRDGTIGLPVYHEFLGKFAEYLYISPTGDVVGKSRISMGTDS
LQPTVVPMDEQNAIAMLRYAGVTHHRVLASRTEDAGRTWSKPFPIDPANPNSALAAVATP
NHGLLVALNDLEDGRFRLRLMETNSSLELWKPVIDLDESPDPEGNPFSPQAYREIIGDKF
RLSSGPRRLSLVDEFLTNLDQRVCKTHGCDFEYEYPYFIRSADGLYHLVYSWNNTFIKHV
SFNDAWLMEQL