Protein Info for PGA1_c22130 in Phaeobacter inhibens DSM 17395

Annotation: putative glutathione transport system permease protein GsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 114 to 140 (27 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 233 to 260 (28 residues), see Phobius details PF12911: OppC_N" amino acids 8 to 32 (25 residues), 26 bits, see alignment (E = 6.8e-10) PF00528: BPD_transp_1" amino acids 85 to 262 (178 residues), 102.5 bits, see alignment E=2.4e-33

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 89% identity to sit:TM1040_1822)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2E2 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PGA1_c22130 putative glutathione transport system permease protein GsiD (Phaeobacter inhibens DSM 17395)
MKNIPISAMIGLLFTALYFLMAIFAPLLAPYGMAEIVGDVWEPRTAEHLLGTDNIGRDLL
SRMIYGGRTTIFIATAATILSFTTGSILGFFAAVSGGWVDQVMSRLVDLVMSIPTLIFAL
VVLSVMPVTVPVLIVVMGLLDSTRVYRLARAVAVDIEVMDYVEAARLRGEKTVWIIFREI
LPNALSPLVAEMGLRFIFMVLFVSTLSFLGLGVQPPEADWGGIVKENKEGIVYGIPAALL
PAIAIATLAISVNLVADWVLNRTTSLKGGRG