Protein Info for Psest_2225 in Pseudomonas stutzeri RCH2

Annotation: Diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details PF01219: DAGK_prokar" amino acids 26 to 127 (102 residues), 107.2 bits, see alignment E=1.8e-35

Best Hits

Swiss-Prot: 64% identical to KDGL_PSEAE: Diacylglycerol kinase (dgkA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 66% identity to pmk:MDS_2286)

MetaCyc: 46% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.107

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLU6 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Psest_2225 Diacylglycerol kinase (Pseudomonas stutzeri RCH2)
MSSIEDLNAQSLKGHQGLKRILRALGYSIAGIRAAVAGEAAFRQLLLLNAVLIPLAFTFE
VSRIERVLLVIVPLLTLVIELVNSAIEATIDRISYELHPLSKNAKDMGSAAQLLSLVVVG
VTWVMILY