Protein Info for Psest_2218 in Pseudomonas stutzeri RCH2

Annotation: Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF02779: Transket_pyr" amino acids 5 to 179 (175 residues), 130.6 bits, see alignment E=5e-42 PF02780: Transketolase_C" amino acids 195 to 315 (121 residues), 125.5 bits, see alignment E=1.2e-40

Best Hits

Swiss-Prot: 46% identical to ODPB1_ARATH: Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial (PDH2) from Arabidopsis thaliana

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 80% identity to avn:Avin_46160)

MetaCyc: 42% identical to pyruvate dehydrogenase E1 component beta subunit (Homo sapiens)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLU1 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Psest_2218 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit (Pseudomonas stutzeri RCH2)
MNNRISYREALREALREALQRDERAFLMGEDVGRYGGTYAVSKGLLEEFGEARIRDTPLS
ELAFVGAGIGAALGGMRPIVEVMTVNFALLALDPLINTAATLRHMSGGQFSVPLVLRMAT
GAGRQLAAQHSHSLEGWFAHVPGLKVLAPATVEDARGMLWPALQDPDPVLIFEHAQLYNL
EDELPPSMAVDIRSARVRRPGSDLSLIAYGGTLHKALQAADQLAEEGIAAEVIDLRVLRP
LDEVTILDSVRKTRRALVVDEGWRSGSLSAEIITRIIEQGFFELDAPPARVCSAEVPIPY
ARHLEEAALPQVPTIIAAARQLLC