Protein Info for Psest_2217 in Pseudomonas stutzeri RCH2

Annotation: Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00364: Biotin_lipoyl" amino acids 4 to 75 (72 residues), 57.1 bits, see alignment E=2e-19 PF02817: E3_binding" amino acids 117 to 151 (35 residues), 48.1 bits, see alignment 1.6e-16 PF00198: 2-oxoacid_dh" amino acids 165 to 382 (218 residues), 191.3 bits, see alignment E=2.7e-60

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 62% identity to tmz:Tmz1t_1415)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex (EC 2.3.1.-)" in subsystem Acetoin, butanediol metabolism (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.12

Use Curated BLAST to search for 2.3.1.- or 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL63 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Psest_2217 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes (Pseudomonas stutzeri RCH2)
MIVFKLPSLGADMDEGTLLQWKVKPGERIERGEVIAVVDTAKAAVDVECWHSGEVLELLV
EPGSKIPVGTPLARLLEPGEAREAALAQSPAPVPVAVAAEQPPVTAVAPPADTSRARISP
VARRRAAELGIDPATLSGSGPHGSVTLQDVEAAAAKAAPADRNAAMRQAIAAAMSRSKRE
IPHYYLSETVAFGAAARWLQAYNAERIPEERLLVSVLLLKAVALALRDYPQLNGYWRDGA
FQPGEGIHLGTAISLRQGGLIAPALHDVAGQPLPQLMQALGDLVQRARAGSLRSSELSDA
TLTVTQLGEQGVDSVFGVIYPPQVALVGVGRIVERPWVEAGALCVMPSVVLSLAADHRAS
DGHYGARFLAEVRRLLQNPEQL