Protein Info for PGA1_c22060 in Phaeobacter inhibens DSM 17395

Annotation: Putative virion core protein (lumpy skin disease virus)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF13421: Band_7_1" amino acids 26 to 236 (211 residues), 336 bits, see alignment E=1.3e-104 PF01145: Band_7" amino acids 43 to 245 (203 residues), 61.5 bits, see alignment E=1.6e-20 PF14237: GYF_2" amino acids 325 to 374 (50 residues), 67.7 bits, see alignment 8.9e-23

Best Hits

KEGG orthology group: None (inferred from 87% identity to sit:TM1040_1817)

Predicted SEED Role

"Putative virion core protein (lumpy skin disease virus)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYD8 at UniProt or InterPro

Protein Sequence (392 amino acids)

>PGA1_c22060 Putative virion core protein (lumpy skin disease virus) (Phaeobacter inhibens DSM 17395)
MGIFDFLKGEFIDVIHWTDDTNDTLVWRFEREGHAIKYGAKLTVREGQAAVFVHEGQLAD
VFTPGLYMLETNNMPVMTTLQHWDHGFQSPFKSEIYFVDTTRFNDLKWGTKNPIMARDPE
FGPVRLRAFGTYSIRVVDPARFLTEIVGTDGEFTMDEISFQIRNIIVQQASRVLAGSGIP
VLDMAANTADLGKLVAAEISATVADYGIAIPELYIENISLPAAVEQALDKRTQMGIVGDL
GRYTQFSAAEAMTAAAQTPNSGMGAGMGMGMGMAMAQQMAQPGAAGHAAGQPAGPWGARP
APAAPQTAPMTAPVAPPPPPVEHVWHIAENGQTTGPFSKARLGRMAQEGGLRRDSLVWTP
GQDGWKAAGDVLELAQLFTILPPPPPPPPPAG