Protein Info for PGA1_c21920 in Phaeobacter inhibens DSM 17395

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 228 to 253 (26 residues), see Phobius details PF01027: Bax1-I" amino acids 23 to 254 (232 residues), 198.1 bits, see alignment E=7.8e-63

Best Hits

KEGG orthology group: K06890, (no description) (inferred from 83% identity to sit:TM1040_1913)

Predicted SEED Role

"FIG005935: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ENP6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_c21920 Integral membrane protein, interacts with FtsH (Phaeobacter inhibens DSM 17395)
MAQFDTIRSTAGARSAEIDAGLRAHMNKVYGTMAVGTFITFLAAWAISGLAVTTDPANAA
AQLSADRYLTSIGYALYASPLKWVIMFAPLAFVFGISAAANRMSAAGVQLLFYVFATVMG
LSISSIFLVFTGESIVQVFLITSIAFAGLSLVGYTTKKDLSGMGAFLIMGLIGLIVLAIA
NMFIASSVLANVISFVGVLIFAGLTAYDTQRIKNEYLQHAHMGDQEWLGKAAIMGALSLY
LDFINMFMMLLQLLGNRE