Protein Info for PGA1_c21840 in Phaeobacter inhibens DSM 17395

Annotation: guanine deaminase GuaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02967: guanine deaminase
  • amino acids 33 to 425 (393 residues), 508.2 bits, E=8e-157
• PF01979: Amidohydro_1
  • amino acids 67 to 425 (359 residues), 161 bits, E=4.8e-51
• PF07969: Amidohydro_3
  • amino acids 255 to 425 (171 residues), 45.2 bits, E=9.7e-16

Best Hits

Swiss-Prot: 41% identical to GUAD_DEIRA: Probable guanine deaminase (guaD) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K01487, guanine deaminase [EC: 3.5.4.3] (inferred from 80% identity to sil:SPO2956)

Predicted SEED Role

"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (10/11 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.3

Use Curated BLAST to search for 3.5.4.3

Sequence Analysis Tools

See I7F0S8 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PGA1_c21840 guanine deaminase GuaD (Phaeobacter inhibens DSM 17395)
MQAEYILRGQVLSFAGTPFEGDSPEAAVKLHEAVTIGGGKVLELGTWDGLRKAHPMAELV
DHGDRLILAGFVDAHVHFPQTAIIASWGKRLIDWLNSYTFPEEMRFGDRAYADEIAGRYL
DLTRANGTTTMCSYCTIHPESVDAFFTAAQARGQRVVAGKTCMDRNAPEGLRDTAQSAHD
DSAALIGRWHGVDRLSYAITPRFSPTSTPEQLEAMGALWADHPDCLMQTHLSEQTDEITW
VKSLFPEARDYLDTYEQFGLLGARGLYGHAIHLEDRERARLREVGAALVHCPTSNTFIGS
GLFDMAGLMAEGQRIGLATDTGGGSSFSMLRTMAAAYEVGQLRGTPLHAAQLLWLATQGS
ARALHMGDQIGNIAPGMEADLVVLDLASTPAIAQRSAGAKDLWESVFATIMMGDDRAVAE
VWINGARD