Protein Info for Psest_0216 in Pseudomonas stutzeri RCH2

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 156 to 296 (141 residues), 44.8 bits, see alignment E=6.6e-16 PF01758: SBF" amino acids 225 to 300 (76 residues), 24.8 bits, see alignment E=1.6e-09

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 94% identity to psa:PST_4030)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGD7 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Psest_0216 Predicted permeases (Pseudomonas stutzeri RCH2)
MTALLLALWPLFALIVAGYCLRLRAFPSVEFWPGAERINYFVLFPALLFSSLATAPLDNP
ALPQLAAAVMLGLGLPWIALLLMKRLRGWPAGRFGAITQGVLRFNTYLGLAAVGSLFGKE
GLALAALMLALMVPTVNVMSVWALTAERGLSVRGLLLPIAKNPLILACVAGALVNLSGLG
LPGGTDRLLSLLAAASLPLGLLCVGAALKPQELGGEIPALGWNCAARLLAVPLLAYGVAR
VLGLPPMETTILVLFFALPTAPTAYVLTRQLGGDSHLMAGIITLQTLLAAASLPLVLTLL
NG