Protein Info for PGA1_c21810 in Phaeobacter inhibens DSM 17395

Annotation: metallophosphoesterase, MG_246/BB_0505 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00149: Metallophos" amino acids 1 to 183 (183 residues), 28.2 bits, see alignment E=2.6e-10 TIGR00282: metallophosphoesterase, MG_246/BB_0505 family" amino acids 1 to 261 (261 residues), 261.2 bits, see alignment E=5.2e-82 PF13277: YmdB" amino acids 4 to 259 (256 residues), 340.8 bits, see alignment E=4.5e-106

Best Hits

Swiss-Prot: 48% identical to PPDE_DEIRA: Phosphatase/phosphodiesterase DR_1281 (DR_1281) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K09769, hypothetical protein (inferred from 84% identity to sit:TM1040_1901)

Predicted SEED Role

"Ser/Thr protein phosphatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYB5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PGA1_c21810 metallophosphoesterase, MG_246/BB_0505 family (Phaeobacter inhibens DSM 17395)
MRLLFLGDVMGRAGRKAISEHLPQMRKDWRLDFVVVNGENASNGMGLNGEHAKALLDAGA
DCLTLGDHAFDQKDMLQAIEKEPRIIRPLNFAKNAPGRGFRLFNAPGGRKVLVVQALGQV
FMKRAYDDPFGAVEAVLKSHPRGGLAQAVIVDMHCEATSEKMAMGHFCNGRASLVVGTHT
HVPTGDAQILSEGTGYLTDAGMCGDYNSVIGMEKAEPMRRFLTGMPKNRFTPAEGSATLS
GVFVETDDRTGAAKSIRMIRVGGLLEQAIP