Protein Info for PGA1_c21790 in Phaeobacter inhibens DSM 17395

Annotation: fumarate reductase/succinate dehydrogenase flavoprotein-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 PF01494: FAD_binding_3" amino acids 9 to 49 (41 residues), 27.2 bits, see alignment 7e-10 PF00890: FAD_binding_2" amino acids 10 to 539 (530 residues), 272.2 bits, see alignment E=2.8e-84 PF12831: FAD_oxidored" amino acids 10 to 61 (52 residues), 28.8 bits, see alignment 2.4e-10 PF13450: NAD_binding_8" amino acids 13 to 50 (38 residues), 29.5 bits, see alignment 2.3e-10

Best Hits

KEGG orthology group: K07077, (no description) (inferred from 80% identity to sit:TM1040_1896)

Predicted SEED Role

"Fumarate/succinate/L-aspartate dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0S4 at UniProt or InterPro

Protein Sequence (556 amino acids)

>PGA1_c21790 fumarate reductase/succinate dehydrogenase flavoprotein-like protein (Phaeobacter inhibens DSM 17395)
MGQPTDNSADVIIVGAGLAGLVAAAELGDRGKRVILLDQEPAHFLGGQAHWSLGGLFMID
TPEQRRMGIRDCPDLARRDWFGSAQFDRPEDHWPQRWARAYLDFASGEMRAWLHGLGMRW
FPVVGWAERGGGDAEGHGNSVPRFHLTWGTGPGVVAPFAERVQANIEAGLIQPRFRHQVS
HIITQGGIVKGVSGEVLASDDAQQGARTNRQEIGEFEVYAPSVLVASGGIGGNLDAVRKN
WPVDRLGPAPRRMVAGVPFHVDGRMIPITEAAGGHVINADRMWHYTEGLRNWDPIWPNHG
IRILPGPSSMWFDARGDRLPAPYLPGFDTLGTLREILKTGQDYSWFILSQKIIQKEFALS
GSEQNPDLTSGKWGEVLRARLLSRGKAPAPVEAFKKHGADFVVADTLSELVAGMNELGEL
PLEETHLRRQIEARDAQADNPFAKDAQLIAINAARNYRGDRLIRTAKPHRLLDRANGPLI
AVRLKILTRKSLGGLQTDLDGQLIGADGATVPGLFAAGEVAGFGGGGYHGYNALEGSFLG
GCLFTGRQAGQSRAIA