Protein Info for PGA1_c21770 in Phaeobacter inhibens DSM 17395

Annotation: DNA-binding regulatory protein, YebC/PmpR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 237 (237 residues), 320 bits, see alignment E=5.5e-100 PF20772: TACO1_YebC_N" amino acids 5 to 74 (70 residues), 115.9 bits, see alignment E=9.4e-38 PF01709: Transcrip_reg" amino acids 81 to 236 (156 residues), 203.6 bits, see alignment E=1.6e-64

Best Hits

Swiss-Prot: 92% identical to Y1893_RUEST: Probable transcriptional regulatory protein TM1040_1893 (TM1040_1893) from Ruegeria sp. (strain TM1040)

KEGG orthology group: None (inferred from 92% identity to sit:TM1040_1893)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ENN5 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PGA1_c21770 DNA-binding regulatory protein, YebC/PmpR family (Phaeobacter inhibens DSM 17395)
MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS
VPKDVIDRAIKKSTAGEGDDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFSKNG
GNLGETGSVGFMFDRKGEVTYSATVGDADTVMMAAIDAGAEDVDSSEDGHVIYCADTDLN
EVSNALEGELGESDSTKLVWKPTTTTELDLEGMQKLMKLVDALEDDDDVQRVTTNFEASD
EVMEQL