Protein Info for PGA1_c21760 in Phaeobacter inhibens DSM 17395

Annotation: putative N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13673: Acetyltransf_10" amino acids 27 to 152 (126 residues), 76 bits, see alignment E=4e-25 PF00583: Acetyltransf_1" amino acids 30 to 131 (102 residues), 46.3 bits, see alignment E=7.1e-16 PF13508: Acetyltransf_7" amino acids 55 to 132 (78 residues), 38.3 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 65% identity to sit:TM1040_2759)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYB1 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PGA1_c21760 putative N-acetyltransferase (Phaeobacter inhibens DSM 17395)
MNIRPFRPEDAAALAQIFHAAVHGVSARDYSPEQCAAWSPQPAPAEAWQERADDGRSVFV
AVDDTDQPQGFIELERDGHIDCFYCHPDVAGTGVGLALYQQLEIRARDLGLGSLYVEASE
AAKRFFTRQGFTDEGRREIERRGVALHNYRMTKVLT