Protein Info for HP15_2098 in Marinobacter adhaerens HP15

Annotation: erythronate-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF00389: 2-Hacid_dh" amino acids 31 to 279 (249 residues), 69.3 bits, see alignment E=4.1e-23 PF02826: 2-Hacid_dh_C" amino acids 114 to 257 (144 residues), 108.4 bits, see alignment E=4.3e-35 PF11890: DUF3410" amino acids 290 to 378 (89 residues), 72.3 bits, see alignment E=3.7e-24

Best Hits

Swiss-Prot: 78% identical to PDXB_MARHV: Erythronate-4-phosphate dehydrogenase (pdxB) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 78% identity to maq:Maqu_1775)

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRF3 at UniProt or InterPro

Protein Sequence (383 amino acids)

>HP15_2098 erythronate-4-phosphate dehydrogenase (Marinobacter adhaerens HP15)
MLIVADENIPLLDSFFGDIGEIRRVSGRSMSNEDVRDADIVLVRSVTRVNRELLEGSRVR
FVGTTTIGTDHVDLDWLEAAGIRFSAAPGCNANSVAEYVLSVLSLHAERRGLADWSQLSV
GIVGVGNVGGELAHKLERLGFDVRLCDPPRADREEEDQEFVSLEEAMKCDVVSLHTPLTR
EGDHPTLHMIGHPELEALGANQLLINAGRGEVIDSSALLARLDQGNAPTVALDVWEQEPR
IHPELVDRVWLATPHIAGYSLEGKVQGTEMIYQALSQFLGLPVRKKAGQFLPEPALSKIS
FTSSADEDDAIRIALRACYDPRPDDARLRNAMTGSVEERGAAFDRLRRDYPVRRECSSLK
IQLKGTSKSLQDSFRAIGFKLKI