Protein Info for HP15_2093 in Marinobacter adhaerens HP15

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 775 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details PF00512: HisKA" amino acids 291 to 356 (66 residues), 61.8 bits, see alignment E=7.6e-21 PF02518: HATPase_c" amino acids 403 to 513 (111 residues), 105.6 bits, see alignment E=3.1e-34 PF00072: Response_reg" amino acids 657 to 768 (112 residues), 101.7 bits, see alignment E=4.2e-33

Best Hits

KEGG orthology group: None (inferred from 76% identity to maq:Maqu_1769)

Predicted SEED Role

"sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRE8 at UniProt or InterPro

Protein Sequence (775 amino acids)

>HP15_2093 signal transduction histidine kinase (Marinobacter adhaerens HP15)
MSNGFKQRLSYRLTRDTVLVAMALGLVLNVVQITLDYFSAKDSMEKEIHALIDISNSPAS
QIAYNIDVRLAEELLDGLLRHPATIDARITDNDDETMAASSKSSPVSPYRWVSDLLFGPD
RVFRQELRVPQLEDLPLGHLIVTIDTYHYGALFLQRAGYTLISGLLKSLILSAALLAIFY
FVLTRPMLNVISALSQVRATSPEKVRLPIPANHREDEIGTMVGIINQHLETIDSSLAQLR
HAESAMKNYSTQLEQEVADRTREISEKNDALQRGNRALVKAKEDAVRRARARANFLASMS
HEIRTPLNGVLGMLGLALEGELDSAQRNRIEIALNAGESLLGLLNDILDISKVEAGKLSL
ENIPFSVRHLIEECATLHAQQARRKRIHLVTEIDPDLPEDFLGDPTRVRQVLNNLLSNAI
KFTDEGSVKLKAAYSGGSLRIDVVDTGIGMSTEGLHRIFSPFSQADAETTRLYGGTGLGL
TLCRQLVERMHGQILVDSREGSGTHFTVTLPLPVHEASEDYDLPRVDSRLKDIGIAMAIP
PDNPHRSAIEAQLRKWGIPIRGASRHPDGILLALANAGDEETLAFADNWQGAGVVLVDSS
GTLPPALGQQQLLSLPLRRDELLRCLLLAAGLLDSEEQTANAVEDDEQTGTEASLKILLV
EDNQVNQMVAVSLLKKLGHRTDHAENGLKAIQALENNHYDLVLMDCQMPVMDGYEATQRI
RQNPEWKELPIIAVTANVMQGDREDCLASGMNDYITKPYKREELRTVIDRWRPAI