Protein Info for PGA1_c21700 in Phaeobacter inhibens DSM 17395

Annotation: HTH-type transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR03384: transcriptional repressor BetI" amino acids 3 to 189 (187 residues), 234.5 bits, see alignment E=3.9e-74 PF00440: TetR_N" amino acids 14 to 59 (46 residues), 50.5 bits, see alignment E=1.5e-17 PF13977: TetR_C_6" amino acids 82 to 188 (107 residues), 79.7 bits, see alignment E=2e-26

Best Hits

Swiss-Prot: 38% identical to BETI_BURTA: HTH-type transcriptional regulator BetI (betI) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: K02167, TetR/AcrR family transcriptional regulator, transcriptional repressor of bet genes (inferred from 81% identity to sit:TM1040_1885)

Predicted SEED Role

"HTH-type transcriptional regulator BetI" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DS22 at UniProt or InterPro

Protein Sequence (191 amino acids)

>PGA1_c21700 HTH-type transcriptional regulator (Phaeobacter inhibens DSM 17395)
MGRKRIRDIRNEELIEATIVAVHRRGYGVVTMAEIAREAGASAASINYYFGSKEGLMEAT
MRHLLNKLREAMIRGYATAKSPKERLYAVMDANFDDELFSVAQCSLWMQFWASAPYSPRL
SRLHRINRSRVRSHFLAELNGLLPPDRVETARHALQCYMDGVWLQAAQSATPLDSAQARR
AAHRVVDLALN