Protein Info for HP15_2077 in Marinobacter adhaerens HP15

Annotation: leucyl/phenylalanyl-tRNA-protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR00667: leucyl/phenylalanyl-tRNA--protein transferase" amino acids 34 to 217 (184 residues), 205.9 bits, see alignment E=2e-65 PF03588: Leu_Phe_trans" amino acids 37 to 205 (169 residues), 246.9 bits, see alignment E=3.8e-78

Best Hits

Swiss-Prot: 54% identical to LFTR_HAHCH: Leucyl/phenylalanyl-tRNA--protein transferase (aat) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K00684, leucyl/phenylalanyl-tRNA--protein transferase [EC: 2.3.2.6] (inferred from 54% identity to hch:HCH_02343)

Predicted SEED Role

"Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)" in subsystem Protein degradation (EC 2.3.2.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRD2 at UniProt or InterPro

Protein Sequence (237 amino acids)

>HP15_2077 leucyl/phenylalanyl-tRNA-protein transferase (Marinobacter adhaerens HP15)
MTSLPWLDPDQLWFPPANEALDDPDGLLALGGDLSTERLILAYRNGIFPWYSDDQPILWW
SPNPRCVLFPNEIHVSRSLRRTLNQQRFQVTADRHFGRIIRLCASTRAEGTWITEEMIAS
YSELHRMGVAHSIEIWNQRGELAGGMYGLAIGRCFFGESMFSLETNASKVLMVHLAHQLQ
LWGYRIMDCQVESRHLLTMGARTIPREEFLSILRMSIDQKPDQTDWTFRWRWPGPEE