Protein Info for Psest_2165 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 117 to 135 (19 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 189 to 215 (27 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF09981: DUF2218" amino acids 6 to 92 (87 residues), 95.4 bits, see alignment E=2.2e-31 PF01292: Ni_hydr_CYTB" amino acids 114 to 279 (166 residues), 104.1 bits, see alignment E=8.3e-34

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 85% identity to psa:PST_2144)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN00 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Psest_2165 Cytochrome B561 (Pseudomonas stutzeri RCH2)
MYRSHSRITASNPSRLIKRLCNHWRHKFAVQLDEQGGVIELPLGRCSLRASEGCLHAQLE
SADQAKLPQFQKVVAEHLERMAGDESLVIRWQSEAGAAPAVQQVENRTLDSRSRYGTVSR
VFHWLMALLIVWQFLKLGDRIGEGEHWVGQTLVPWHVSLGAVLMVLVLLRIVWSLSQLKQ
RPQHDPATAWLVTGGHMALYACMLLMPITGVLYLVGNGYGLKVFGQQLVEKGPEIAWAAS
VGDVHSPLAWLTVLLVAGHVGAALYHRLVKRDDIMQRML