Protein Info for Psest_2159 in Pseudomonas stutzeri RCH2

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 23 to 40 (18 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 247 to 276 (30 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 30 to 303 (274 residues), 51.2 bits, see alignment E=6.7e-18

Best Hits

Swiss-Prot: 50% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 93% identity to psa:PST_2151)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIX7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psest_2159 Predicted integral membrane protein (Pseudomonas stutzeri RCH2)
MSDTSKGEPKSGWRRRWPLIKKILTYVFFALVVGLLIGLARNLDWQEVYNTLRNYKAQTL
WMAGAAAFGSYVVYCFFDVLGKRYARHDLPIRQILPVTFVCYAFNLNLSAWVGGIALRFR
LYSRFGLKPSQITRVFTMSILTNWLGYMWLAGMIFAMGWIKPPASWEIGFTALRILGGGL
LVACLVYLGLCGFSKRRSWTIRGHEIQLPSLRLALIQLVLGAANWSLMALVVYYMFSQKA
AYPEVLGILMISSIAGVVTHIPAGLGVIEAVFVAMLADEMSKGAIVGGLIGYRVIYFLIP
LLFATLVYVVLEARAKKLRSNNQASEQQTVSQ