Protein Info for HP15_2070 in Marinobacter adhaerens HP15

Annotation: outer membrane-specific lipoprotein transporter subunit LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 314 to 342 (29 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 4 to 413 (410 residues), 539.1 bits, see alignment E=3.6e-166 PF12704: MacB_PCD" amino acids 27 to 239 (213 residues), 60.7 bits, see alignment E=2.4e-20 PF02687: FtsX" amino acids 273 to 406 (134 residues), 67 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 46% identical to LOLC_XYLFT: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 89% identity to maq:Maqu_1747)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRC5 at UniProt or InterPro

Protein Sequence (413 amino acids)

>HP15_2070 outer membrane-specific lipoprotein transporter subunit LolE (Marinobacter adhaerens HP15)
MFRPLSLYIGLRYTAAKRRNHFISFISLTSMIGLMLGVAVLIIVLSVMNGFDRELKQRIL
GMVPHATIQGAGPLDDWQSIDAKVQQHPRVLAAAPFIQGQGMVTGGGNVRGVVLNGILPE
EERTVSIIENHMVEGSLNDLVSGEFGIIIGRLMAASLRLQIGDKVTVVLPEASVTPAGVL
PRLKRFTVKGIFSVGAELDGNYTLIHMDDAAKLMRTGGKAEGIRLLVDDLFAAPKVSQQA
AESLGGRYYVSDWTRTHGNLFQAIRMEKTMIGLLLMFIVAVAAFNIVSTLVMVVTDKTGD
IAILRTMGATPGRIMRIFIVQGAVIGIFGTIVGTALGVFGALNISAFISWLEGALGHQFL
SADVYFISYLPSQLQWQDVFIISGAGLAMSLLATIYPAWRASRVDPAEALRYE