Protein Info for Psest_2152 in Pseudomonas stutzeri RCH2

Annotation: formate dehydrogenase, beta subunit, Fe-S containing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 11 to 289 (279 residues), 441.1 bits, E=7e-137
• PF12800: Fer4_4
  • amino acids 40 to 51 (12 residues), 12.7 bits, see alignment (E = 8.4e-05)
  • amino acids 134 to 148 (15 residues), 15.3 bits, see alignment (E = 1.2e-05)
• PF12838: Fer4_7
  • amino acids 41 to 117 (77 residues), 32.8 bits, E=4.3e-11
• PF13247: Fer4_11
  • amino acids 95 to 191 (97 residues), 87.1 bits, E=4.4e-28
• PF13237: Fer4_10
  • amino acids 97 to 147 (51 residues), 33.9 bits, 1.3e-11
• PF00037: Fer4
  • amino acids 130 to 150 (21 residues), 25.9 bits, see alignment (E = 3.7e-09)
• PF13187: Fer4_9
  • amino acids 135 to 187 (53 residues), 28.8 bits, 5.7e-10
• PF09163: Form-deh_trans
  • amino acids 249 to 292 (44 residues), 67.8 bits, 3.2e-22

Best Hits

Swiss-Prot: 64% identical to FDNH_ECOLI: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Escherichia coli (strain K12)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 96% identity to psa:PST_2158)

MetaCyc: 64% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• nitrate reduction III (dissimilatory) (2/2 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See L0GL06 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Psest_2152 formate dehydrogenase, beta subunit, Fe-S containing (Pseudomonas stutzeri RCH2)
MRGDQINLQNIIARSATTEPSPQIRSGGVEKVTKLIDVSVCIGCKACQVACMEWNDLRDE
VGECDGTYNAPQDLTPSSFEVMRFSEYENEEGDLEWLIRKDNCMHCAEPGCLKACPSPGA
IVQYANGIVDFNSEHCIGCGYCVAGCPFNIPRISKKDNKAYKCTLCSDRVYHGLEPACVK
SCPTGAIQFGTKEQMLDYGAHRVGKLNERGYENAGMYDPAGVGGTHVVYVLQHADKPEIY
SGLPKDPHISPTVEMWKGVTKPIMSAVLGVSVLAGFFHYMTKGPKEEPEDDPDPAKANAE
REQNLRDEERRP